PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400016560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 236aa    MW: 26528.6 Da    PI: 6.825
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400016560genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.62.9e-27959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          k+i+n + rqvtfskRr g++KKAeELSvLCda+va+iifs tgkl++++s
  PGSC0003DMP400016560  9 KKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFDFAS 59
                          68**********************************************986 PP

2K-box46.91.2e-16951712399
                 K-box  23 kLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                           +L k++    re+R++ Ge+Le Lsl+eLqq+e++Le + +++ + K   ++++i +lq+k  el eenk+L+ k+e
  PGSC0003DMP400016560  95 RLSKQVADKTRELRQMRGEELEGLSLEELQQIEKRLEAGFNRVLEIKGTRIMDEITNLQRKGAELMEENKQLKYKME 171
                           78888888899*************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.772161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-30372IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-26323IPR002100Transcription factor, MADS-box
PfamPF003195.3E-251057IPR002100Transcription factor, MADS-box
CDDcd002655.23E-321277No hitNo description
PRINTSPR004043.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.36686176IPR002487Transcription factor, K-box
PfamPF014868.3E-1595170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0048438Biological Processfloral whorl development
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MAREKIKIKK IDNITARQVT FSKRRRGLFK KAEELSVLCD ADVALIIFSA TGKLFDFAST  60
SMKDILGKYK LQSASLEKVD QPSLDLQLEN SLNMRLSKQV ADKTRELRQM RGEELEGLSL  120
EELQQIEKRL EAGFNRVLEI KGTRIMDEIT NLQRKGAELM EENKQLKYKM EIMKKGKLPL  180
LTDMMMEEGQ SSESIITTNN PDQDDSSNAS LKLGGTTAVE DDCSITSLKL GLPFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-19169169Myocyte-specific enhancer factor 2B
1tqe_Q5e-19169169Myocyte-specific enhancer factor 2B
1tqe_R5e-19169169Myocyte-specific enhancer factor 2B
1tqe_S5e-19169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6437330.0AY643733.1 Solanum tuberosum MADS16 (MADS16) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006338063.11e-169PREDICTED: MADS16 protein isoform X1
SwissprotQ9FVC19e-87SVP_ARATH; MADS-box protein SVP
TrEMBLM1AJQ81e-169M1AJQ8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000242471e-168(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9382377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.16e-79MIKC_MADS family protein
Publications ? help Back to Top
  1. He C,Saedler H
    Heterotopic expression of MPF2 is the key to the evolution of the Chinese lantern of Physalis, a morphological novelty in Solanaceae.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(16): p. 5779-84
    [PMID:15824316]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Carmona MJ,Ortega N,Garcia-Maroto F
    Isolation and molecular characterization of a new vegetative MADS-box gene from Solanum tuberosum L.
    Planta, 1998. 207(2): p. 181-8
    [PMID:9951721]